| request information: |
|
| Catalog Code: | H00023636-M01 |
| Product Name: | NUP62 Antibody |
| Product Description: | Mouse Monoclonal anti-NUP62 (1F12) |
| Clone: | 1F12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23636 |
| Gene Symbol: | NUP62 |
| Omim ID: | 605815 |
| Immunogen: | NUP62 (AAH50717, 1 a.a. ~ 523 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLATQTPATQTTGFTFGTA
TLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGF
SFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGL
SLCTPVTTAGAPTAGTQG |
| Specificity: | NUP62 - nucleoporin 62kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins and is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. Multiple transcript variants of this gene encode a single protein isoform. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp547L134 antibody, anti-FLJ20822 antibody, anti-MGC841 antibody, anti-p62 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |