ExactAntigen

Mouse Polyclonal anti-SPO11 - SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae), MaxPab Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00023626-B01
ProductName:SPO11 Antibody
Product Description:Mouse Polyclonal anti-SPO11 - SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae), MaxPab Antibody
Clonality:Polyclonal
Immunogen:SPO11 (NP_937998, 1 a.a. ~ 358 a.a) full-length human protein.
Epitope:MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASRFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGS ...
CrossReactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot.
Background:Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ALTnames:anti-MGC39953 antibody
ProteinTarget:SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae)
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:23626
Gene_Symbol:SPO11
see all human SPO11 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about