| request information: |
|
| Catalog Code: | H00023626-A01 |
| Product Name: | SPO11 meiotic protein covalently bound to DSB-like Antibody |
| Product Description: | Mouse Polyclonal anti-SPO11 meiotic protein covalently bound to DSB-like |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23626 |
| Gene Symbol: | SPO11 |
| Omim ID: | 605114, |
| Immunogen: | SPO11 (NP_036576, 291 a.a. ~ 396 a.a) partial recombinant protein with GST tag. |
| Epitope: | YGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAE
IQALTFLSSDYLSRVYLPNKLKFGGW* |
| Specificity: | SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC39953 antibody, anti-SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae) antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |