| request information: |
|
| Catalog Code: | H00023581-M01 |
| Product Name: | CASP14 Antibody |
| Product Description: | Mouse Monoclonal anti-CASP14 (4C9) |
| Clone: | 4C9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23581 |
| Gene Symbol: | CASP14 |
| Omim ID: | 605848, |
| Immunogen: | CASP14 (NP_036246, 133 a.a. ~ 243 a.a) partial recombinant protein with GST tag. |
| Epitope: | RGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTR
RMAEAELVQEGKARKTNPEIQSTLRKRLYLQ* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo. The expression and processing of this caspase may be involved in keratinocyte terminal differentiation, which is important for the formation of the skin barrier. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC119078 antibody, anti-MGC119079 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |