ExactAntigen

Mouse Polyclonal anti-CASP14 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00023581-A01
ProductName: CASP14 Antibody
Product Description: Mouse Polyclonal anti-CASP14
Clonality: Polyclonal
Immunogen: CASP14 (NP_036246, 133 a.a. ~ 243 a.a) partial recombinant protein with GST tag.
Epitope: RGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ* ...
Specificity: CASP14 - caspase 14, apoptosis-related cysteine protease
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml Whole antisera Mouse antisera.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera
Background: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo. The expression and processing of this caspase may be involved in keratinocyte terminal differentiation, which is important for the formation of the skin barrier.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-MICE antibody
ProteinTarget: CASP14 - caspase 14, apoptosis-related cysteine protease
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 23581
Gene_Symbol: CASP14
Omim_ID: 605848 H00023581-M01
more information: company product webpage
Also see:
see all human caspase 14 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about