| request information: |
|
| Catalog Code: | H00023569-M01 |
| Product Name: | peptidyl arginine deiminase, type IV Antibody |
| Product Description: | Mouse Monoclonal anti-peptidyl arginine deiminase, type IV (4D8) |
| Clone: | 4D8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23569 |
| Gene Symbol: | PADI4 |
| Omim ID: | 180300, 605347, |
| Immunogen: | PADI4 (2 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTM
KAASGSTGDQKVQISYYGPKTPPVKALLYL* |
| Specificity: | peptidyl arginine deiminase, type IV |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PAD antibody, anti-PADI5 antibody, anti-PDI4 antibody, anti-PDI5 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |