ExactAntigen

Mouse Polyclonal anti-peptidyl arginine deiminase, type IV
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00023569-A01
ProductName:peptidyl arginine deiminase, type IV Antibody
Product Description:Mouse Polyclonal anti-peptidyl arginine deiminase, type IV
Clonality:Polyclonal
Immunogen:PADI4 (-, 2 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Epitope:AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL* ...
Specificity:peptidyl arginine deiminase, type IV
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested.
Background:This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-PAD antibody, anti-PADI5 antibody, anti-PDI4 antibody, anti-PDI5 antibody
ProteinTarget:peptidyl arginine deiminase, type IV
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:23569
Gene_Symbol:PADI4
Omim_ID:180300, 605347,
see all human PADI4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about