| CatalogCode: | H00023569-A01 |
| ProductName: | peptidyl arginine deiminase, type IV Antibody |
| Product Description: | Mouse Polyclonal anti-peptidyl arginine deiminase, type IV |
| Clonality: | Polyclonal |
| Immunogen: | PADI4 (-, 2 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL* ... |
| Specificity: | peptidyl arginine deiminase, type IV |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-PAD antibody, anti-PADI5 antibody, anti-PDI4 antibody, anti-PDI5 antibody |
| ProteinTarget: | peptidyl arginine deiminase, type IV |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 23569 |
| Gene_Symbol: | PADI4 |
| Omim_ID: | 180300, 605347, |