| request information: |
|
| Catalog Code: | H00023559-M06 |
| Product Name: | WBP1 Antibody |
| Product Description: | Mouse Monoclonal anti-WBP1 (5F6) |
| Clone: | 5F6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23559 |
| Gene Symbol: | WBP1 |
| Omim ID: | 606961, |
| Immunogen: | WBP1 (NP_036609, 170 a.a. ~ 268 a.a) partial recombinant protein with GST tag. |
| Epitope: | GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCAL
PPESVPQIFPMGLSSSEGD* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein, which binds to the WW domain of Yes kinase-associated protein by a conserved region: XPPXY motif. The function of this protein has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC15305 antibody, anti-WBP-1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |