| request information: |
|
| Catalog Code: | H00023549-M01 |
| Product Name: | DNPEP Antibody |
| Product Description: | Mouse Monoclonal anti-DNPEP (2F9-3A7) |
| Clone: | 2F9-3A7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23549 |
| Gene Symbol: | DNPEP |
| Immunogen: | DNPEP (AAH00653, 1 a.a. ~ 476 a.a) full length recombinant protein with GST tag. |
| Epitope: | MQVAMNGKARKEAVQTAAKELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNSSTIIAFAVG
GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVKCPTSGRLEQQLVHVE
RPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGPLNAVDERHHSVLMSLLCAHLGLSPKDIVE
MELCLADTQPAVLGGAYD |
| Specificity: | DNPEP - aspartyl aminopeptidase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | The protein encoded by this gene is an aminopeptidase which prefers acidic amino acids, and specifically favors aspartic acid over glutamic acid. It is thought to be a cytosolic protein involved in general metabolism of intracellular proteins. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ASPEP antibody, anti-DAP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |