| request information: |
|
| Catalog Code: | H00023523-A01 |
| Product Name: | CABIN1 Antibody |
| Product Description: | Mouse Polyclonal anti-CABIN1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23523 |
| Gene Symbol: | CABIN1 |
| Omim ID: | 604251 |
| Immunogen: | CABIN1 (NP_036427, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLREAVSSGDEKE
GLKHPGLILKYSTYKNLAQLAAQREDLETAM* |
| Specificity: | CABIN1 - calcineurin binding protein 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Calcineurin plays an important role in the T-cell receptor-mediated signal transduction pathway. The protein encoded by this gene binds specifically to the activated form of calcineurin and inhibits calcineurin-mediated signal transduction. The encoded protein is found in the nucleus and contains a leucine zipper domain as well as several PEST motifs, sequences which confer targeted degradation to those proteins which contain them. At least four alternatively spliced transcripts have been found for this gene, but the full-length nature of most of them has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CAIN antibody, anti-KIAA0330 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |