| CatalogCode: | H00023499-M01 |
| ProductName: | MACF1 Antibody |
| Product Description: | Mouse Monoclonal anti-MACF1 (6G7) |
| Clone: | 6G7 |
| Clonality: | Monoclonal |
| Immunogen: | MACF1 (AAH07330, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. |
| Epitope: | KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF ... |
| Specificity: | MACF1 - microtubule-actin crosslinking factor 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene belongs to the plakin family of cytoskeletal linker proteins. This protein family forms bridges between different cytoskeletal elements through specialized modular domains. The encoded protein is one of the largest size proteins identified in human cytoskeletal proteins. It has functional actin and microtubule binding domains, and it appears to stabilize actin at sites where microtubules and microfilaments meet. It may function in microtubule dynamics to facilitate actin-microtubule interactions at the cell periphery and to couple the microtubule network to cellular junctions. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ABP620 antibody, anti-ACF7 antibody, anti-FLJ46776 antibody, anti-KIAA0465 antibody, anti-KIAA1251 antibody, anti-MACF antibody, anti-OFC4 antibody |
| ProteinTarget: | MACF1 - microtubule-actin crosslinking factor 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 23499 |
| Gene_Symbol: | MACF1 |
| Omim_ID: | 608271, |
order or
more information: | company product webpage |
| request information: |
|