| request information: |
|
| Catalog Code: | H00023499-A01 |
| Product Name: | MACF1 Antibody |
| Product Description: | Mouse Polyclonal anti-MACF1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23499 |
| Gene Symbol: | MACF1 |
| Omim ID: | 608271, |
| Immunogen: | MACF1 (AAH07330, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. |
| Epitope: | KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELR
EKFILPEGASQGMTPF |
| Specificity: | MACF1 - microtubule-actin crosslinking factor 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. |
| Background: | The protein encoded by this gene belongs to the plakin family of cytoskeletal linker proteins. This protein family forms bridges between different cytoskeletal elements through specialized modular domains. The encoded protein is one of the largest size proteins identified in human cytoskeletal proteins. It has functional actin and microtubule binding domains, and it appears to stabilize actin at sites where microtubules and microfilaments meet. It may function in microtubule dynamics to facilitate actin-microtubule interactions at the cell periphery and to couple the microtubule network to cellular junctions. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ABP620 antibody, anti-ACF7 antibody, anti-FLJ46776 antibody, anti-KIAA0465 antibody, anti-KIAA1251 antibody, anti-MACF antibody, anti-OFC4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |