| request information: |
|
| Catalog Code: | H00023479-M01 |
| Product Name: | NIFUN Antibody |
| Product Description: | Mouse Monoclonal anti-NIFUN (3B8-1C4) |
| Clone: | 3B8-1C4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23479 |
| Gene Symbol: | NIFUN |
| Immunogen: | NIFUN (AAH11906, 23 a.a. ~ 167 a.a) full length recombinant protein with GST tag. |
| Epitope: | RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSL
ATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK |
| Specificity: | NIFUN - NifU-like N-terminal domain containing |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-2310020H20Rik antibody, anti-ISCU antibody, anti-ISU2 antibody, anti-MGC74517 antibody, anti-NIFU antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |