ExactAntigen

hairy/enhancer-of-split related with YRPW motif 1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00023462-M09
Product Name:hairy/enhancer-of-split related with YRPW motif 1 Antibody
Product Description:Mouse Monoclonal anti-hairy/enhancer-of-split related with YRPW motif 1 (1F11)
Clone:1F11
Clonality:Monoclonal
ListPrice:295
Gene ID:23462
Gene Symbol:HEY1
Omim ID:602953,
Immunogen:HEY1 (NP_036390, 121 a.a. ~ 221 a.a) partial recombinant protein with GST tag.
Epitope:DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQN
GHGNAGTTASPTEPHHQGRLG*
Specificity:hairy/enhancer-of-split related with YRPW motif 1
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:1X PBS pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-CHF-2 antibody, anti-CHF2 antibody, anti-HERP2 antibody, anti-HESR-1 antibody, anti-HESR1 antibody, anti-HRT-1 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human HEY1 antibodies


2008©ExactAntigen home | browse | about