| request information: | |
| Catalog Code: | H00023462-M02 |
| Product Name: | hairy/enhancer-of-split related with YRPW motif 1 Antibody |
| Product Description: | Mouse Monoclonal anti-hairy/enhancer-of-split related with YRPW motif 1 (2F10) |
| Clone: | 2F10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23462 |
| Gene Symbol: | HEY1 |
| Omim ID: | 602953, |
| Immunogen: | HEY1 (NP_036390, 121 a.a. ~ 221 a.a) partial recombinant protein with GST tag. |
| Epitope: | DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQN GHGNAGTTASPTEPHHQGRLG* |
| Specificity: | hairy/enhancer-of-split related with YRPW motif 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CHF-2 antibody, anti-CHF2 antibody, anti-HERP2 antibody, anti-HESR-1 antibody, anti-HESR1 antibody, anti-HRT-1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |