ExactAntigen

Mouse Monoclonal anti-hairy/enhancer-of-split related with YRPW motif 1 (3B3) | Novus Biologicals antibody product information
CatalogCode:H00023462-M01
ProductName:hairy/enhancer-of-split related with YRPW motif 1 Antibody
Product Description:Mouse Monoclonal anti-hairy/enhancer-of-split related with YRPW motif 1 (3B3)
Clone:3B3
Clonality:Monoclonal
Immunogen:HEY1 (NP_036390, 121 a.a. ~ 221 a.a) partial recombinant protein with GST tag.
Epitope:DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG* ...
Specificity:hairy/enhancer-of-split related with YRPW motif 1
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:1X PBS pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-CHF-2 antibody, anti-CHF2 antibody, anti-HERP2 antibody, anti-HESR-1 antibody, anti-HESR1 antibody, anti-HRT-1 antibody
ProteinTarget:hairy/enhancer-of-split related with YRPW motif 1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:23462
Gene_Symbol:HEY1
Omim_ID:602953,
order or
more information
:
company product webpage
request information:
Also see:
all human HEY1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about