ExactAntigen

Mouse Monoclonal anti-solute carrier family 44, member 1 (1C4) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00023446-M02
ProductName: solute carrier family 44, member 1 Antibody
Product Description: Mouse Monoclonal anti-solute carrier family 44, member 1 (1C4)
Clone: 1C4
Clonality: Monoclonal
Immunogen: SLC44A1 (NP_536856, 74 a.a. ~ 184 a.a) partial recombinant protein with GST tag.
Epitope: TKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISC* ...
Specificity: solute carrier family 44, member 1
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
Buffer: 1X PBS pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-CDW92 antibody, anti-CHTL1 antibody, anti-CTL1 antibody, anti-RP11-287A8.1 antibody
ProteinTarget: solute carrier family 44, member 1
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 23446
Gene_Symbol: SLC44A1
Omim_ID: 606105,
more information: company product webpage
Also see:
see all human SLC44A1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about