| CatalogCode: | H00023443-M01 |
| ProductName: | SLC35A3 Antibody |
| Product Description: | Mouse Monoclonal anti-SLC35A3 (4B6) |
| Clone: | 4B6 |
| Clonality: | Monoclonal |
| Immunogen: | SLC35A3 (NP_036375, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. |
| Epitope: | DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATY* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA. The antibody is also shown to be specific in Western blot against cell lysates. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZp781P1297 antibody |
| ProteinTarget: | solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 23443 |
| Gene_Symbol: | SLC35A3 |
| Omim_ID: | 605632, |
order or
more information: | company product webpage |
| request information: |
|