ExactAntigen

ELA3B Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00023436-M04
Product Name:ELA3B Antibody
Product Description:Mouse Monoclonal anti-ELA3B (2H6)
Clone:2H6
Clonality:Monoclonal
ListPrice:295
Gene ID:23436
Gene Symbol:ELA3B
Immunogen:ELA3B (AAH05216, 19 a.a. ~ 271 a.a) full length recombinant protein with GST tag.
Epitope:GPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVKEGPE
QVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQ
EALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTR
VSAFIDWIEETIASH*
Specificity:ELA3B - elastase 3B, pancreatic
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein on ELISA.
Background:Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3B has little elastolytic activity. Like most of the human elastases, elastase 3B is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3B preferentially cleaves proteins after alanine residues. Elastase 3B may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Ascites
Isotype:IgG1 Kappa
Host Name:Mouse
Application Summary:ELISA
Species Summary:Hu ,
Alternate Names:anti-ELA3A antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human ELA3B antibodies


2008©ExactAntigen home | browse | about