| CatalogCode: | H00023403-A01 |
| ProductName: | FBXO46 Antibody |
| Product Description: | Mouse Polyclonal anti-FBXO46 |
| Clonality: | Polyclonal |
| Immunogen: | FBXO46 (XP_371179, 176 a.a. ~ 276 a.a) partial recombinant protein with GST tag. |
| Epitope: | VALVEQRAALALQSYPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNGREPRAPD* ... |
| Specificity: | FBXO46 - F-box protein 46 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | Members of the F-box protein family, such as FBXO46, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-20D7-FC4 antibody, anti-FBXO34L antibody, anti-Fbx46 antibody |
| ProteinTarget: | FBXO46 - F-box protein 46 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 23403 |
| Gene_Symbol: | FBXO46 |
| Omim_ID: | 609117 H00026271-A01 |
order or
more information: | company product webpage |
| request information: |
|