| Catalog Code: | H00023397-M01 |
| Product Type: | Primary Antibody |
| Product Name: | BRRN1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 23397 |
| Host: | Mouse |
| Clone: | 1C9 |
| Isotype: | IgG1 kappa |
| Product Description: | Mouse Monoclonal anti-BRRN1 (1C9) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = BRRN1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours. |
| Alternate Names: | anti-HCAP-H antibody, anti-MGC4616 antibody |
| Immunogen: | BRRN1 (AAH24211, 645 a.a. ~ 741 a.a) partial recombinant protein with GST tag. |
| Epitope: | KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD ... |
| Specificity: | BRRN1 - barren homolog (Drosophila) |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | BRRN1 |
| Omim ID: | 602332 |