| request information: |
|
| Catalog Code: | H00023396-M10 |
| Product Name: | PIP5K1C Antibody |
| Product Description: | Mouse Monoclonal anti-PIP5K1C (7D11) |
| Clone: | 7D11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23396 |
| Gene Symbol: | PIP5K1C |
| Omim ID: | 606102, |
| Immunogen: | PIP5K1C (NP_036530, 561 a.a. ~ 668 a.a) partial recombinant protein with GST tag. |
| Epitope: | RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPA GASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDE RSWVYSPLHYSAQAPPASDGESD* |
| Specificity: | PIP5K1C - phosphatidylinositol-4-phosphate 5-kinase, type I, gamma |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cell Membrane |
| Background: | This gene encodes a member of the type I phosphatidylinositol-4-phosphate 5-kinase family of enzymes. A similar protein in mice is found in synapses and focal adhesion plaques, and binds the FERM domain of talin through its C-terminus. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-diphosphoinositide kinase antibody, anti-Phosphatidylinositol 4 phosphate 5 kinase type 1 gamma antibody, anti-PIP5K1 gamma antibody, anti-PIP5K1C protein antibody, anti-PIP5K1G antibody, anti-PtdIns(4)P 5 kinase gamma antibody, anti-type I PIP kinase antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |