ExactAntigen

ADNP Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00023394-M01
Product Name:ADNP Antibody
Product Description:Mouse Monoclonal anti-ADNP (6B8)
Clone:6B8
Clonality:Monoclonal
ListPrice:295
Gene ID:23394
Gene Symbol:ADNP
Immunogen:ADNP (NP_056154, 1018 a.a. ~ 1103 a.a) partial recombinant protein with GST tag.
Epitope:TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSN PQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQ A*
Specificity:ADNP - activity-dependent neuroprotector
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Localization:Nuclear
Background:Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG3 Kappa
Host Name:Mouse
Buffer:Phosphate buffered saline, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-Activity dependent neuroprotective protein antibody, anti-Activity dependent neuroprotector antibody, anti-ADNP antibody, anti-KIAA0784 antibody
Package Size:0.05 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human activity dependent neuroprotective protein antibodies


2008©ExactAntigen home | browse | about