| request information: |
|
| Catalog Code: | H00023394-M01 |
| Product Name: | ADNP Antibody |
| Product Description: | Mouse Monoclonal anti-ADNP (6B8) |
| Clone: | 6B8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23394 |
| Gene Symbol: | ADNP |
| Immunogen: | ADNP (NP_056154, 1018 a.a. ~ 1103 a.a) partial recombinant protein with GST tag. |
| Epitope: | TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSN PQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQ A* |
| Specificity: | ADNP - activity-dependent neuroprotector |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nuclear |
| Background: | Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Activity dependent neuroprotective protein antibody, anti-Activity dependent neuroprotector antibody, anti-ADNP antibody, anti-KIAA0784 antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |