| request information: |
|
| Catalog Code: | H00023385-A01 |
| Product Name: | NCSTN Antibody |
| Product Description: | Mouse Polyclonal anti-NCSTN |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23385 |
| Gene Symbol: | NCSTN |
| Omim ID: | 605254 |
| Immunogen: | NCSTN (AAH47621, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag. |
| Epitope: | VERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGR
TSRIAGLAVSLTKPSPASGFS |
| Specificity: | NCSTN - nicastrin |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a Type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may be a stabilizing cofactor required for gamma-secretase complex assembly. The cleavage of beta-amyloid precursor protein yields amyloid beta peptide, the main component of the neuritic plaque and the hallmark lesion in the brains of patients with Alzheimer's disease; however, the nature of the encoded protein's role in Alzheimer's disease is not known for certain. Alternatively spliced transcript variants have been described, but their full-length nature has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-APH2 antibody, anti-KIAA0253 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |