| request information: | |
| Catalog Code: | H00023369-M03 |
| Product Name: | PUM2 Antibody |
| Product Description: | Mouse Monoclonal anti-PUM2 (7B8) |
| Clone: | 7B8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23369 |
| Gene Symbol: | PUM2 |
| Omim ID: | 607205, |
| Immunogen: | PUM2 (NP_056132, 701 a.a. ~ 799 a.a) partial recombinant protein with GST tag. |
| Epitope: | DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSR FIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFF EFGSLDQKLALATR* |
| Specificity: | PUM2 - pumilio homolog 2 (Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cytoplasmic |
| Background: | Pumilio 2, a human homolog of Pumilio, a protein required to maintain germ line stem cells in Drosophila and Caenorhabditis elegans, forms a stable complex with DAZ through the same functional domain required for RNA binding, protein-protein interactions and rescue of Pumilio mutations in flies. Pumilio 2 is expressed predominantly in human embryonic stem cells and germ cells and colocalizes with DAZ and DAZL in germ cells. Pumilio 2 is a component of conserved cellular machinery that may be required for germ cell development. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Pumilio 2 antibody, anti-FLJ36528 antibody, anti-KIAA0235 antibody, anti-MGC138251 antibody, anti-MGC138253 antibody, anti-PUM 2 antibody, anti-Pum2 antibody, anti-PUMH2 antibody, anti-Pumilio (Drosphila) homolog 2 antibody, anti-Pumilio homolog 2 (Drosophila) antibody, anti-Pumilio homolog 2 antibody, anti-Pumilio2 antibody, anti-PUML2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |