ExactAntigen

Mouse Monoclonal anti-PUM2 (1C8) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00023369-M02
ProductName: PUM2 Antibody
Product Description: Mouse Monoclonal anti-PUM2 (1C8)
Clone: 1C8
Clonality: Monoclonal
Immunogen: PUM2 (NP_056132, 701 a.a. ~ 799 a.a) partial recombinant protein with GST tag.
Epitope: DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQKLALATR* ...
Specificity: PUM2 - pumilio homolog 2 (Drosophila)
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-PUM2 antibody, anti-PUMH2 antibody, anti-PUML2 antibody, anti-KIAA0235 antibody, anti-pumilio homolog 2 (Drosophila) antibody, anti-pumilio (Drosphila) homolog 2 antibody
ProteinTarget: PUM2 - pumilio homolog 2 (Drosophila)
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 23369
Gene_Symbol: PUM2
Omim_ID: 607205,
more information: company product webpage
Also see:
see all human PUM2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about