ExactAntigen

PUM2 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00023369-M01
Product Name:PUM2 Antibody
Product Description:Mouse Monoclonal anti-PUM2 (5B6)
Clone:5B6
Clonality:Monoclonal
ListPrice:295
Gene ID:23369
Gene Symbol:PUM2
Omim ID:607205,
Immunogen:PUM2 (NP_056132, 701 a.a. ~ 799 a.a) partial recombinant protein with GST tag.
Epitope:DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSR FIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFF EFGSLDQKLALATR*
Specificity:PUM2 - pumilio homolog 2 (Drosophila)
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Localization:Cytoplasmic
Background:Pumilio 2, a human homolog of Pumilio, a protein required to maintain germ line stem cells in Drosophila and Caenorhabditis elegans, forms a stable complex with DAZ through the same functional domain required for RNA binding, protein-protein interactions and rescue of Pumilio mutations in flies. Pumilio 2 is expressed predominantly in human embryonic stem cells and germ cells and colocalizes with DAZ and DAZL in germ cells. Pumilio 2 is a component of conserved cellular machinery that may be required for germ cell development.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host Name:Mouse
Buffer:Phosphate buffered saline, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-Pumilio 2 antibody, anti-FLJ36528 antibody, anti-KIAA0235 antibody, anti-MGC138251 antibody, anti-MGC138253 antibody, anti-PUM 2 antibody, anti-Pum2 antibody, anti-PUMH2 antibody, anti-Pumilio (Drosphila) homolog 2 antibody, anti-Pumilio homolog 2 (Drosophila) antibody, anti-Pumilio homolog 2 antibody, anti-Pumilio2 antibody, anti-PUML2 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human PUM2 antibodies


2008©ExactAntigen home | browse | about