| CatalogCode: | H00023353-B01 |
| ProductName: | UNC84A Antibody |
| Product Description: | Mouse Polyclonal anti-UNC84A - unc-84 homolog A (C. elegans) |
| Clone: | unc-84 homolog A (C. elegans) |
| Clonality: | Polyclonal |
| Immunogen: | UNC84A (AAH13613, 1 a.a. ~ 258 a.a) full-length human protein. |
| Epitope: | MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGSKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKI ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-FLJ12407 antibody, anti-KIAA0810 antibody, anti-SUN1 antibody |
| ProteinTarget: | unc-84 homolog A (C. elegans) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 23353 |
| Gene_Symbol: | UNC84A |
order or
more information: | company product webpage |
| request information: |
|