| request information: |
|
| Catalog Code: | H00023345-A01 |
| Product Name: | SYNE1 Antibody |
| Product Description: | Mouse Polyclonal anti-SYNE1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23345 |
| Gene Symbol: | SYNE1 |
| Omim ID: | 608441 |
| Immunogen: | SYNE1 (NP_892006, 1561 a.a. ~ 1671 a.a) partial recombinant protein with GST tag. |
| Epitope: | LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDI
LRRAKERQTALENLLAHWQRLEKELSSFLTW* |
| Specificity: | SYNE1 - spectrin repeat containing, nuclear envelope 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | This gene encodes a spectrin repeat containing protein expressed in skeletal and smooth muscle, and peripheral blood lymphocytes, that localizes to the nuclear membrane. Mutations in this gene have been associated with autosomal recessive spinocerebellar ataxia 8, also referred to as autosomal recessive cerebellar ataxia type 1 or recessive ataxia of Beauce. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-8B antibody, anti-CPG2 antibody, anti-DKFZp781J13156 antibody, anti-FLJ30878 antibody, anti-KIAA0796 antibody, anti-KIAA1262 antibody, anti-KIAA1756 antibody, anti-MYNE-1 antibody, anti-MYNE1 antibody, anti-SYNE-1 antibody, anti-SYNE-1B antibody, anti-dJ398G3.1 antibody, anti-dJ398G3.2 antibody, anti-nesprin-1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |