| CatalogCode: | H00023332-M02 |
| ProductName: | CLASP1 Antibody |
| Product Description: | Mouse Monoclonal anti-CLASP1 (6A11) |
| Clone: | 6A11 |
| Clonality: | Monoclonal |
| Immunogen: | CLASP1 (NP_056097, 1133 a.a. ~ 1227 a.a) partial recombinant protein with GST tag. |
| Epitope: | DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT* ... |
| Specificity: | CLASP1 - cytoplasmic linker associated protein 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170; MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [PubMed 12837247]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZp686D1968 antibody, anti-DKFZp686H2039 antibody, anti-KIAA0622 antibody, anti-MAST1 antibody |
| ProteinTarget: | CLASP1 - cytoplasmic linker associated protein 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 23332 |
| Gene_Symbol: | CLASP1 |
| Omim_ID: | 605852, |
order or
more information: | company product webpage |
| request information: |
|