| CatalogCode: | H00023332-A01 |
| ProductName: | CLASP1 Antibody |
| Product Description: | Mouse Polyclonal anti-CLASP1 |
| Clonality: | Polyclonal |
| Immunogen: | CLASP1 (NP_056097, 1133 a.a. ~ 1227 a.a) partial recombinant protein with GST tag. |
| Epitope: | DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT* ... |
| Specificity: | CLASP1 - cytoplasmic linker associated protein 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170; MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [PubMed 12837247]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZp686D1968 antibody, anti-DKFZp686H2039 antibody, anti-KIAA0622 antibody, anti-MAST1 antibody |
| ProteinTarget: | CLASP1 - cytoplasmic linker associated protein 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 23332 |
| Gene_Symbol: | CLASP1 |
| Omim_ID: | 605852, |
order or
more information: | company product webpage |
| request information: |
|