ExactAntigen

Mouse Monoclonal anti-KIAA0056 (1D5)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00023310-M01
ProductName:KIAA0056 Antibody
Product Description:Mouse Monoclonal anti-KIAA0056 (1D5)
Clone:1D5
Clonality:Monoclonal
Immunogen:KIAA0056 (AAH11408, 1 a.a. ~ 341 a.a) full length recombinant protein with GST tag.
Epitope:MRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAI ...
Specificity:hCAP-D3 - KIAA0056 protein
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background:Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPD3 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ProteinTarget:hCAP-D3 - KIAA0056 protein
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:23310
Gene_Symbol:hCAP-D3
Omim_ID:609276 NB100-79787
see all human NCAPD3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about