| request information: |
|
| Catalog Code: | H00023308-M04 |
| Product Name: | ICOSLG Antibody |
| Product Description: | Mouse Monoclonal anti-ICOSLG (2D12) |
| Clone: | 2D12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23308 |
| Gene Symbol: | ICOSLG |
| Omim ID: | 605717 |
| Immunogen: | ICOSLG (AAH64637, 20 a.a. ~ 303 a.a) partial recombinant protein with GST tag. |
| Epitope: | TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQ NSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQS LGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNV YWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIEN VLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVV |
| Specificity: | ICOSLG - inducible T-cell co-stimulator ligand |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-B7-H2 antibody, anti-B7H2 antibody, anti-B7RP-1 antibody, anti-B7RP1 antibody, anti-CD275 antibody, anti-GL50 antibody, anti-ICOS-L antibody, anti-ICOSL antibody, anti-KIAA0653 antibody, anti-LICOS antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |