ExactAntigen

ICOSLG Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00023308-M03
Product Type:Primary Antibody
Product Name:ICOSLG Antibody
List Price:275
Clonality:Monoclonal
Gene ID:23308
Host:Mouse
Clone:4D12
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-ICOSLG (4D12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = ICOSLG PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-B7-H2 antibody, anti-B7H2 antibody, anti-B7RP-1 antibody, anti-B7RP1 antibody, anti-CD275 antibody, anti-GL50 antibody, anti-ICOS-L antibody, anti-ICOSL antibody, anti-KIAA0653 antibody, anti-LICOS antibody
Immunogen:ICOSLG (AAH64637, 20 a.a. ~ 303 a.a) partial recombinant protein with GST tag.
Epitope:TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQ NSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQS LGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNV YWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIEN VLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVV
Specificity:ICOSLG - inducible T-cell co-stimulator ligand
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ICOSLG
Omim ID:605717
see all human ICOSLG antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about