| request information: | |
| Catalog Code: | H00023236-A01 |
| Product Name: | PLCB1 Antibody |
| Product Description: | Mouse Polyclonal anti-PLCB1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23236 |
| Gene Symbol: | PLCB1 |
| Omim ID: | 607120 |
| Immunogen: | PLCB1 (NP_056007, 1107 a.a. ~ 1217 a.a) partial recombinant protein with GST tag. |
| Epitope: | VQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLS LSSDPGKVNHKTPSSEELGGDIPGKEFDTPL* |
| Specificity: | PLCB1 - phospholipase C, beta 1 (phosphoinositide-specific) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. This gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PI-PLC antibody, anti-PLC-154 antibody, anti-PLC-I antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |