| request information: |
|
| Catalog Code: | H00023224-A01 |
| Product Name: | SYNE2 Antibody |
| Product Description: | Mouse Polyclonal anti-SYNE2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23224 |
| Gene Symbol: | SYNE2 |
| Omim ID: | 608442, |
| Immunogen: | SYNE2 (NP_055995, 6701 a.a. ~ 6800 a.a) partial recombinant protein with GST tag. |
| Epitope: | CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSF
DEVDSGDQPPATSVPAPRA* |
| Specificity: | SYNE2 - spectrin repeat containing, nuclear envelope 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZP434H2235 antibody, anti-DKFZp686H1931 antibody, anti-FLJ46790 antibody, anti-KIAA1011 antibody, anti-NUA antibody, anti-NUANCE antibody, anti-Nesprin-2 antibody, anti-SYNE-2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |