ExactAntigen

PTDSR Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00023210-M01
Product Type:Primary Antibody
Product Name:PTDSR Antibody
List Price:275
Clonality:Monoclonal
Gene ID:23210
Host:Mouse
Product Description:Mouse Monoclonal anti-PTDSR
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 23210 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-KIAA0585 antibody, anti-PSR antibody, anti-PTDSR1 antibody
Immunogen:PTDSR (NP_055982, 2 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFK* ...
Specificity:PTDSR - phosphatidylserine receptor
Purity:Whole antisera
Packaging:100 ug of purified IgG.
Package Size:100 ug
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PTDSR
Omim ID:604914,
see all human phosphatidylserine receptor antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about