| request information: |
|
| Catalog Code: | H00023210-A01 |
| Product Name: | PTDSR Antibody |
| Product Description: | Mouse Polyclonal anti-PTDSR |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23210 |
| Gene Symbol: | PTDSR |
| Omim ID: | 604914, |
| Immunogen: | PTDSR (NP_055982, 2 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNAQEGWS
AQEKWTLERLKRKYRNQKFK* |
| Specificity: | PTDSR - phosphatidylserine receptor |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KIAA0585 antibody, anti-PSR antibody, anti-PTDSR1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |