ExactAntigen

ATP11B Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00023200-M01
Product Type:Primary Antibody
Product Name:ATP11B Antibody
List Price:275
Clonality:Monoclonal
Gene ID:23200
Host:Mouse
Clone:4H8
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-ATP11B (4H8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = ATP11B PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-ATPIF antibody, anti-ATPIR antibody, anti-DKFZP434J238 antibody, anti-DKFZP434N1615 antibody, anti-KIAA0956 antibody, anti-MGC46576 antibody
Immunogen:ATP11B (NP_055431, 1087 a.a. ~ 1178 a.a) partial recombinant protein with GST tag.
Epitope:DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC* ...
Specificity:ATP11B - ATPase, Class VI, type 11B
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ATP11B
Omim ID:605869,
see all human ATP11B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about