| CatalogCode: | H00023200-A01 |
| ProductName: | ATP11B Antibody |
| Product Description: | Mouse Polyclonal anti-ATP11B |
| Clonality: | Polyclonal |
| Immunogen: | ATP11B (NP_055431, 1087 a.a. ~ 1178 a.a) partial recombinant protein with GST tag. |
| Epitope: | DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC* ... |
| Specificity: | ATP11B - ATPase, Class VI, type 11B |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | P-type ATPases, such as ATP11B, are phosphorylated in their intermediate state and drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily transports heavy metal ions, such as Cu(2+) or Cd(2+). Another subfamily transports non-heavy metal ions, such as H(+), Na(+), K(+), or Ca(+). A third subfamily transports amphipaths, such as phosphatidylserine.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ATPIF antibody, anti-ATPIR antibody, anti-DKFZP434J238 antibody, anti-DKFZP434N1615 antibody, anti-KIAA0956 antibody, anti-MGC46576 antibody |
| ProteinTarget: | ATP11B - ATPase, Class VI, type 11B |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 23200 |
| Gene_Symbol: | ATP11B |
| Omim_ID: | 605869 H00023200-M01 |
order or
more information: | company product webpage |
| request information: |
|