| CatalogCode: | H00023189-M01 |
| ProductName: | ANKRD15 Antibody |
| Product Description: | Mouse Monoclonal anti-ANKRD15 (2B8) |
| Clone: | 2B8 |
| Clonality: | Monoclonal |
| Immunogen: | ANKRD15 (AAH38116, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag. |
| Epitope: | MGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDD ... |
| Specificity: | ANKRD15 - ankyrin repeat domain 15 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a protein containing four ankyrin repeat domains in its C-terminus. The suggested role for this protein is in tumorigenesis of renal cell carcinoma. Two alternatively spliced transcript variants encoding different isoforms have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZp451G231 antibody, anti-KANK antibody, anti-KIAA0172 antibody, anti-MGC43128 antibody |
| ProteinTarget: | ANKRD15 - ankyrin repeat domain 15 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 23189 |
| Gene_Symbol: | ANKRD15 |
| Omim_ID: | 607704, |
order or more information: | company product webpage |
| request information: | |