| request information: |
|
| Catalog Code: | H00023166-A01 |
| Product Name: | STAB1 Antibody |
| Product Description: | Mouse Polyclonal anti-STAB1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23166 |
| Gene Symbol: | STAB1 |
| Omim ID: | 608560, |
| Immunogen: | STAB1 (NP_055951, 1804 a.a. ~ 1903 a.a) partial recombinant protein with GST tag. |
| Epitope: | EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLR
LNTCSICGLEPPCPEGSQEQ* |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant STAB1. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 16 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to endocytose ligands such as low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein rapidly cycles between the plasma membrane and early endosomes. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CLEVER1 antibody, anti-FEEL1 antibody, anti-FELE1 antibody, anti-KIAA0246 antibody, anti-STAB1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |