| Catalog Code: | H00023113-M01 |
| Product Type: | Primary Antibody |
| Product Name: | PARC Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 23113 |
| Host: | Mouse |
| Clone: | 3F7 |
| Product Description: | Mouse Monoclonal anti-PARC (3F7) |
| Species Summary: | Hu |
| Background: | Entrez GeneID：23113 |
| Alternate Names: | anti-PARC antibody, anti-P53-associated parkin-like cytoplasmic protein antibody, anti-H7AP1 antibody, anti-H7-AP1 antibody, anti-UbcH7 associated protein 1 antibody, anti-Putative E3 ubiquitin ligase antibody, anti-KIAA0708 antibody |
| Immunogen: | PARC (NP_055904, 918 a.a. ~ 1026 a.a) partial recombinant protein with GST tag. |
| Epitope: | MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITRLLDF* ... |
| Purity: | protein A purified |
| Buffer: | 1x PBS, pH 7.2 |
| Packaging: | 0.1 ml protein A purified Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PARC |
| Omim ID: | 607489, |