| request information: |
|
| Catalog Code: | H00023113-A01 |
| Product Name: | PARC Antibody |
| Product Description: | Mouse Polyclonal anti-PARC |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23113 |
| Gene Symbol: | PARC |
| Omim ID: | 607489 |
| Immunogen: | PARC (NP_055904, 918 a.a. ~ 1026 a.a) partial recombinant protein with GST tag. |
| Epitope: | MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFL
LLLRTLDAPGPNKTLLLSVLRVITRLLDF* |
| Specificity: | PARC - p53-associated parkin-like cytoplasmic protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PARC antibody, anti-P53-associated parkin-like cytoplasmic protein antibody, anti-H7AP1 antibody, anti-H7-AP1 antibody, anti-UbcH7 associated protein 1 antibody, anti-Putative E3 ubiquitin ligase antibody, anti-KIAA0708 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |