| CatalogCode: | H00023057-A01 |
| ProductName: | NMNAT2 Antibody |
| Product Description: | Mouse Polyclonal anti-NMNAT2 |
| Clonality: | Polyclonal |
| Immunogen: | NMNAT2 (NP_055854, 208 a.a. ~ 308 a.a) partial recombinant protein with GST tag. |
| Epitope: | CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG* ... |
| Specificity: | NMNAT2 - nicotinamide nucleotide adenylyltransferase 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-C1orf15 antibody, anti-KIAA0479 antibody, anti-MGC2756 antibody, anti-PNAT-2 antibody, anti-PNAT2 antibody |
| ProteinTarget: | NMNAT2 - nicotinamide nucleotide adenylyltransferase 2 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 23057 |
| Gene_Symbol: | NMNAT2 |
| Omim_ID: | 608701 H00023057-M01 |
order or
more information: | company product webpage |
| request information: |
|