ExactAntigen

SMG1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00023049-M03
Product Name:SMG1 Antibody
Product Description:Mouse Monoclonal anti-SMG1 (1C12)
Clone:1C12
Clonality:Monoclonal
ListPrice:295
Gene ID:23049
Gene Symbol:SMG1
Omim ID:607032,
Immunogen:SMG1 (2922 a.a. ~ 3032 a.a) partial recombinant protein with GST tag.
Epitope:PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRR
MSVAEQVDYVIKEATNLDNLAQLYEGWTAWV*
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Background:This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-61E3.4 antibody, anti-ATX antibody, anti-KIAA0421 antibody, anti-LIP antibody
Package Size:0.1 mg
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human SMG1 antibodies


2008©ExactAntigen home | browse | about