| request information: | |
| Catalog Code: | H00023049-M02 |
| Product Name: | SMG1 Antibody |
| Product Description: | Mouse Monoclonal anti-SMG1 (1A8) |
| Clone: | 1A8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23049 |
| Gene Symbol: | SMG1 |
| Omim ID: | 607032, |
| Immunogen: | SMG1 (2922 a.a. ~ 3032 a.a) partial recombinant protein with GST tag. |
| Epitope: | PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRR MSVAEQVDYVIKEATNLDNLAQLYEGWTAWV* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-61E3.4 antibody, anti-ATX antibody, anti-KIAA0421 antibody, anti-LIP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or more information: | company product webpage |