| request information: |
|
| Catalog Code: | H00023049-M01 |
| Product Name: | SMG1 Antibody |
| Product Description: | Mouse Monoclonal anti-SMG1 (1G5) |
| Clone: | 1G5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23049 |
| Gene Symbol: | SMG1 |
| Omim ID: | 607032 |
| Immunogen: | SMG1 (2922 a.a. ~ 3032 a.a) partial recombinant protein with GST tag. |
| Epitope: | PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRR
MSVAEQVDYVIKEATNLDNLAQLYEGWTAWV* |
| Specificity: | SMG1 - PI-3-kinase-related kinase SMG-1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SMG1 antibody, anti-SMG-1 antibody, anti-PI-3-kinase-related kinase SMG1 antibody, anti-ATX antibody, anti-LIP antibody, anti-Lambda/iota protein kinase C interacting protein antibody, anti-KIAA0421 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |