| request information: |
|
| Catalog Code: | H00023043-M03 |
| Product Name: | TNIK Antibody |
| Product Description: | Mouse Monoclonal anti-TNIK (3D4) |
| Clone: | 3D4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23043 |
| Gene Symbol: | TNIK |
| Immunogen: | TNIK (AAH55427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREG
TLMIRETSGEKKRSGHSDSNGFAGHINLPDL |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Germinal center kinases (GCKs), such as TNIK, are characterized by an N-terminal kinase domain and a C-terminal GCK domain that serves a regulatory function (Fu et al., 1999 [PubMed 10521462]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AD 2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |