ExactAntigen

Mouse Monoclonal anti-TNIK (4E4) | Novus Biologicals antibody product information
CatalogCode:H00023043-M02
ProductName:TNIK Antibody
Product Description:Mouse Monoclonal anti-TNIK (4E4)
Clone:4E4
Clonality:Monoclonal
Immunogen:TNIK (AAH55427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Epitope:MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDL ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:Germinal center kinases (GCKs), such as TNIK, are characterized by an N-terminal kinase domain and a C-terminal GCK domain that serves a regulatory function (Fu et al., 1999 [PubMed 10521462]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-AD 2 antibody
ProteinTarget:TRAF2 and NCK interacting kinase
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:23043
Gene_Symbol:TNIK
order or
more information
:
company product webpage
request information:
Also see:
all human TNIK antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about